Lineage for d2wn6a1 (2wn6 A:17-216)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000766Species Clostridium difficile [TaxId:1496] [231449] (5 PDB entries)
  8. 3000771Domain d2wn6a1: 2wn6 A:17-216 [231452]
    automated match to d1giqa1
    complexed with gol, ndp

Details for d2wn6a1

PDB Entry: 2wn6 (more details), 1.96 Å

PDB Description: structural basis for substrate recognition in the enzymatic component of adp-ribosyltransferase toxin cdta from clostridium difficile
PDB Compounds: (A:) ADP-ribosyltransferase enzymatic component

SCOPe Domain Sequences for d2wn6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wn6a1 d.166.1.0 (A:17-216) automated matches {Clostridium difficile [TaxId: 1496]}
lkdkekakewerkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansr
ekeykelrnaisknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnk
lfkqdgfkdislwepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidk
ivrividgkhyikaeasvvs

SCOPe Domain Coordinates for d2wn6a1:

Click to download the PDB-style file with coordinates for d2wn6a1.
(The format of our PDB-style files is described here.)

Timeline for d2wn6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wn6a2