SCOPe 2.06: Domain d2wn4a1: 2wn4 A:28-216

Lineage for d2wn4a1 (2wn4 A:28-216)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Clostridium difficile [TaxId:1496] [231449] (5 PDB entries)

8. Domain d2wn4a1: 2wn4 A:28-216 [231450]
   automated match to d1giqa1

Details for d2wn4a1

PDB Entry: 2wn4, 1.85 Å

PDB Description: structural basis for substrate recognition in the enzymatic component of adp-ribosyltransferase toxin cdta from clostridium difficile

PDB Compounds: (A:) ADP-ribosyltransferase enzymatic component

SCOPe Domain Sequences for d2wn4a1:

Sequence, based on SEQRES records:

>d2wn4a1 d.166.1.0 (A:28-216) automated matches {Clostridium difficile [TaxId: 1496]}
rkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansrekeykelrnai
sknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnklfkqdgfkdis
lyepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidkivrividgkhy
ikaeasvvs

Sequence, based on observed residues (ATOM records):

>d2wn4a1 d.166.1.0 (A:28-216) automated matches {Clostridium difficile [TaxId: 1496]}
rkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansrekeykelrnai
sknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnklfkqdgfkdis
lyepgkgdekptpllmhlklprntgmlpytntvstlieqgysikidkivrividgkhyik
aeasvvs

Timeline for d2wn4a1:

• d2wn4a1 first appeared in SCOPe 2.03
  
• d2wn4a1 appears in SCOPe 2.05
  
• d2wn4a1 appears in SCOPe 2.07
  
• d2wn4a1 appears in the current release, SCOPe 2.08