![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
![]() | Protein automated matches [191197] (6 species) not a true protein |
![]() | Species Clostridium difficile [TaxId:1496] [231449] (5 PDB entries) |
![]() | Domain d2wn4a1: 2wn4 A:28-216 [231450] automated match to d1giqa1 |
PDB Entry: 2wn4 (more details), 1.85 Å
SCOPe Domain Sequences for d2wn4a1:
Sequence, based on SEQRES records: (download)
>d2wn4a1 d.166.1.0 (A:28-216) automated matches {Clostridium difficile [TaxId: 1496]} rkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansrekeykelrnai sknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnklfkqdgfkdis lyepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidkivrividgkhy ikaeasvvs
>d2wn4a1 d.166.1.0 (A:28-216) automated matches {Clostridium difficile [TaxId: 1496]} rkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansrekeykelrnai sknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnklfkqdgfkdis lyepgkgdekptpllmhlklprntgmlpytntvstlieqgysikidkivrividgkhyik aeasvvs
Timeline for d2wn4a1: