Lineage for d2wlka1 (2wlk A:11-138)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456013Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1456014Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1456015Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1456020Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)
  7. 1456021Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
    Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
  8. 1456028Domain d2wlka1: 2wlk A:11-138 [231445]
    Other proteins in same PDB: d2wlka2, d2wlkb2
    automated match to d1xl4a2
    complexed with cl, k, spm

Details for d2wlka1

PDB Entry: 2wlk (more details), 2.8 Å

PDB Description: structure of the atp-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum
PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2wlka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wlka1 f.14.1.1 (A:11-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl
iyarftrp

SCOPe Domain Coordinates for d2wlka1:

Click to download the PDB-style file with coordinates for d2wlka1.
(The format of our PDB-style files is described here.)

Timeline for d2wlka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wlka2