SCOPe 2.03: Domain d2wlkb2: 2wlk B:139-301

Lineage for d2wlkb2 (2wlk B:139-301)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (4 PDB entries)
   Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690

8. Domain d2wlkb2: 2wlk B:139-301 [231444]
   Other proteins in same PDB: d2wlka1, d2wlkb1
   automated match to d1xl4a1
   complexed with cl, k, spm

Details for d2wlkb2

PDB Entry: 2wlk, 2.8 Å

PDB Description: structure of the atp-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (B:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2wlkb2:

Sequence; same for both SEQRES and ATOM records:

>d2wlkb2 b.1.18.16 (B:139-301) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhhh

Timeline for d2wlkb2:

• d2wlkb2 is new in SCOPe 2.03-stable
  
• d2wlkb2 appears in SCOPe 2.04
  
• d2wlkb2 appears in the current release, SCOPe 2.08