SCOPe 2.08: Domain d2wl9c2: 2wl9 C:135-299

Lineage for d2wl9c2 (2wl9 C:135-299)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries)

8. Domain d2wl9c2: 2wl9 C:135-299 [231440]
   automated match to d2wl3a2
   complexed with fe, gol, mbd, mg

Details for d2wl9c2

PDB Entry: 2wl9, 1.9 Å

PDB Description: crystal structure of catechol 2,3-dioxygenase

PDB Compounds: (C:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d2wl9c2:

Sequence; same for both SEQRES and ATOM records:

>d2wl9c2 d.32.1.0 (C:135-299) automated matches {Rhodococcus sp. [TaxId: 186196]}
pmfgkfvtegqglghiiireddveeatrfyrllglegaveykfalpngavgtpvfmhcnd
rhhslafgvgpmdkrinhlmieythlddlgyahdlvrqqkidvtlqigkhsndealtfyc
anpsgwlwepgwgsrpapaqqehylrdifghdnevegygldiplk

Timeline for d2wl9c2:

• d2wl9c2 first appeared in SCOPe 2.03
  
• d2wl9c2 appears in SCOPe 2.07