Lineage for d1aspa3 (1asp A:339-552)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528133Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1528134Protein Ascorbate oxidase [49555] (1 species)
    consists of three domains of this fold
  7. 1528135Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries)
  8. 1528156Domain d1aspa3: 1asp A:339-552 [23144]
    complexed with cu, nag, oh, peo

Details for d1aspa3

PDB Entry: 1asp (more details), 2.59 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms
PDB Compounds: (A:) ascorbate oxidase

SCOPe Domain Sequences for d1aspa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aspa3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

SCOPe Domain Coordinates for d1aspa3:

Click to download the PDB-style file with coordinates for d1aspa3.
(The format of our PDB-style files is described here.)

Timeline for d1aspa3: