| Class b: All beta proteins [48724] (141 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins) |
| Protein Ascorbate oxidase [49555] (1 species) consists of three domains of this fold |
| Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries) |
| Domain d1aspa3: 1asp A:339-552 [23144] |
PDB Entry: 1asp (more details), 2.59 Å
SCOP Domain Sequences for d1aspa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aspa3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp
Timeline for d1aspa3: