Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (9 proteins) |
Protein automated matches [231410] (1 species) not a true protein |
Species Zoogloea ramigera [TaxId:350] [231411] (6 PDB entries) |
Domain d2wl6b1: 2wl6 B:4-268 [231433] Other proteins in same PDB: d2wl6a2 automated match to d1qfla1 mutant |
PDB Entry: 2wl6 (more details), 2.98 Å
SCOPe Domain Sequences for d2wl6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl6b1 c.95.1.1 (B:4-268) automated matches {Zoogloea ramigera [TaxId: 350]} siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta gnasglndgaaaallmseaeasrrg
Timeline for d2wl6b1:
View in 3D Domains from other chains: (mouse over for more information) d2wl6a1, d2wl6a2, d2wl6c1, d2wl6d1 |