| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
| Protein automated matches [231410] (2 species) not a true protein |
| Species Zoogloea ramigera [TaxId:350] [231411] (6 PDB entries) |
| Domain d2wkvb1: 2wkv B:4-268 [231420] Other proteins in same PDB: d2wkva2, d2wkvb2, d2wkvc2, d2wkvd2 automated match to d1qfla1 complexed with coa, na, so4; mutant |
PDB Entry: 2wkv (more details), 2.5 Å
SCOPe Domain Sequences for d2wkvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkvb1 c.95.1.1 (B:4-268) automated matches {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg
Timeline for d2wkvb1: