Lineage for d1aspa1 (1asp A:1-129)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11162Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 11163Protein Ascorbate oxidase [49555] (1 species)
  7. 11164Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)
  8. 11183Domain d1aspa1: 1asp A:1-129 [23142]

Details for d1aspa1

PDB Entry: 1asp (more details), 2.59 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

SCOP Domain Sequences for d1aspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aspa1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
vdppqgkke

SCOP Domain Coordinates for d1aspa1:

Click to download the PDB-style file with coordinates for d1aspa1.
(The format of our PDB-style files is described here.)

Timeline for d1aspa1: