Lineage for d2wkta2 (2wkt A:269-392)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1393190Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries)
  8. 1393195Domain d2wkta2: 2wkt A:269-392 [231414]
    Other proteins in same PDB: d2wkta1
    automated match to d1m3ka2
    complexed with cl, coa, k, na, so4; mutant

Details for d2wkta2

PDB Entry: 2wkt (more details), 2 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the n316a mutant with coenzyme a.
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wkta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkta2 c.95.1.0 (A:269-392) automated matches {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaaeafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d2wkta2:

Click to download the PDB-style file with coordinates for d2wkta2.
(The format of our PDB-style files is described here.)

Timeline for d2wkta2: