SCOP 1.67: Domain d1asqb3: 1asq B:339-552

Lineage for d1asqb3 (1asq B:339-552)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)

6. Protein Ascorbate oxidase [49555] (1 species)
   consists of three domains of this fold

7. Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)

8. Domain d1asqb3: 1asq B:339-552 [23141]
   complexed with azi, cu, nag, oh

Details for d1asqb3

PDB Entry: 1asq, 2.32 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

SCOP Domain Sequences for d1asqb3:

Sequence; same for both SEQRES and ATOM records:

>d1asqb3 b.6.1.3 (B:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

Timeline for d1asqb3:

• d1asqb3 first appeared (with stable ids) in SCOP 1.55
  
• d1asqb3 appears in SCOP 1.65
  
• d1asqb3 appears in SCOP 1.69
  
• d1asqb3 appears in the current release, SCOPe 2.08