SCOPe 2.05: Domain d2wgea2: 2wge A:260-416

Lineage for d2wgea2 (2wge A:260-416)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (52 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196910] (11 PDB entries)

8. Domain d2wgea2: 2wge A:260-416 [231400]
   automated match to d4c6va2
   complexed with gol, ipa, na, tlm

Details for d2wgea2

PDB Entry: 2wge, 1.8 Å

PDB Description: Crystal structure of KasA of Mycobacterium tuberculosis with bound TLM

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d2wgea2:

Sequence; same for both SEQRES and ATOM records:

>d2wgea2 c.95.1.0 (A:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd
aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe
idldvvageprygdyryavnnsfgfgghnvalafgry

Timeline for d2wgea2:

• d2wgea2 first appeared in SCOPe 2.03
  
• d2wgea2 appears in SCOPe 2.04
  
• d2wgea2 appears in SCOPe 2.06
  
• d2wgea2 appears in the current release, SCOPe 2.08