SCOPe 2.06: Domain d2we1a2: 2we1 A:121-256

Lineage for d2we1a2 (2we1 A:121-256)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (8 species)
   not a true protein

7. Species Human herpesvirus 4 [TaxId:10377] [231386] (4 PDB entries)

8. Domain d2we1a2: 2we1 A:121-256 [231390]
   automated match to d2bsya2
   complexed with so4, ump; mutant

Details for d2we1a2

PDB Entry: 2we1, 1.8 Å

PDB Description: ebv dutpase mutant asp131asn with bound dump

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2we1a2:

Sequence, based on SEQRES records:

>d2we1a2 b.85.4.1 (A:121-256) automated matches {Human herpesvirus 4 [TaxId: 10377]}
gpinhpqypgnvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
frwasctfeevpslam

Sequence, based on observed residues (ATOM records):

>d2we1a2 b.85.4.1 (A:121-256) automated matches {Human herpesvirus 4 [TaxId: 10377]}
gpinpgnvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgilvkpc
rwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprslfrwa
sctfeevpslam

Timeline for d2we1a2:

• d2we1a2 first appeared in SCOPe 2.03
  
• d2we1a2 appears in SCOPe 2.05
  
• d2we1a2 appears in SCOPe 2.07
  
• d2we1a2 appears in the current release, SCOPe 2.08