SCOP 1.59: Domain d1asqa3: 1asq A:339-552

Lineage for d1asqa3 (1asq A:339-552)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)

6. Protein Ascorbate oxidase [49555] (1 species)

7. Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)

8. Domain d1asqa3: 1asq A:339-552 [23138]

Details for d1asqa3

PDB Entry: 1asq, 2.32 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

SCOP Domain Sequences for d1asqa3:

Sequence; same for both SEQRES and ATOM records:

>d1asqa3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

Timeline for d1asqa3:

• d1asqa3 first appeared (with stable ids) in SCOP 1.55
  
• d1asqa3 appears in SCOP 1.57
  
• d1asqa3 appears in SCOP 1.61
  
• d1asqa3 appears in the current release, SCOPe 2.08