Lineage for d1asqa3 (1asq A:339-552)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Ascorbate oxidase, C-terminal domain [418904] (1 species)
    protein consists of three domains of this fold
  7. Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [419306] (4 PDB entries)
  8. 2771251Domain d1asqa3: 1asq A:339-552 [23138]
    Other proteins in same PDB: d1asqa1, d1asqa2, d1asqb1, d1asqb2
    complexed with azi, cu, nag, oh
    has additional insertions and/or extensions that are not grouped together

Details for d1asqa3

PDB Entry: 1asq (more details), 2.32 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms
PDB Compounds: (A:) ascorbate oxidase

SCOPe Domain Sequences for d1asqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asqa3 b.6.1.3 (A:339-552) Ascorbate oxidase, C-terminal domain {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

SCOPe Domain Coordinates for d1asqa3:

Click to download the PDB-style file with coordinates for d1asqa3.
(The format of our PDB-style files is described here.)

Timeline for d1asqa3: