SCOPe 2.07: Domain d2w9ca1: 2w9c A:1-240

Lineage for d2w9ca1 (2w9c A:1-240)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein automated matches [231300] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231301] (28 PDB entries)

8. Domain d2w9ca1: 2w9c A:1-240 [231377]
   Other proteins in same PDB: d2w9ca2, d2w9cb2
   automated match to d1jx4a2
   protein/DNA complex; complexed with mg, ttp

Details for d2w9ca1

PDB Entry: 2w9c, 2.87 Å

PDB Description: ternary complex of dpo4 bound to n2,n2-dimethyl-deoxyguanosine modified dna with incoming dttp

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2w9ca1:

Sequence; same for both SEQRES and ATOM records:

>d2w9ca1 e.8.1.7 (A:1-240) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakarylislardeynepirtr

Timeline for d2w9ca1:

• d2w9ca1 first appeared in SCOPe 2.03
  
• d2w9ca1 appears in SCOPe 2.06
  
• d2w9ca1 appears in the current release, SCOPe 2.08