Lineage for d2w8ra_ (2w8r A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141255Species Human (Homo sapiens) [TaxId:9606] [225691] (17 PDB entries)
  8. 2141303Domain d2w8ra_: 2w8r A: [231375]
    automated match to d2w8na_
    complexed with adp, gol, so4

Details for d2w8ra_

PDB Entry: 2w8r (more details), 2.4 Å

PDB Description: The crystal structure of human SSADH in complex with NAD+
PDB Compounds: (A:) succinate-semialdehyde dehydrogenase, mitochondrial

SCOPe Domain Sequences for d2w8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8ra_ c.82.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laglsaallrtdsfvggrwlpaaatfpvqdpasgaalgmvadcgvrearaavraayeafc
rwrevsakerssllrkwynlmiqnkddlariitaesgkplkeahgeilysafflewfsee
arrvygdiihtpakdrralvlkqpigvaavitpwnfpsamitrkvgaalaagctvvvkpa
edtpfsalalaelasqagipsgvynvipcsrknakevgeaictdplvskisftgstttgk
illhhaansvkrvsmelgglapfivfdsanvdqavagamaskfrntgqtavcsnqflvqr
gihdafvkafaeamkknlrvgngfeegttqgplinekavekvekqvndavskgatvvtgg
krhqlgknffeptllcnvtqdmlctheetfgplapvikfdteeeaiaianaadvglagyf
ysqdpaqiwrvaeqlevgmvgvneglissvecpfggvkqsglgregskygideylelkyv
cyggl

SCOPe Domain Coordinates for d2w8ra_:

Click to download the PDB-style file with coordinates for d2w8ra_.
(The format of our PDB-style files is described here.)

Timeline for d2w8ra_: