SCOPe 2.07: Domain d2w23a_: 2w23 A:

Lineage for d2w23a_ (2w23 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)

8. Domain d2w23a_: 2w23 A: [231372]
   automated match to d4fcna_
   complexed with ca, gol, hem, so4; mutant

Details for d2w23a_

PDB Entry: 2w23, 1.94 Å

PDB Description: structure of mutant w169y of pleurotus eryngii versatile peroxidase (vp)

PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d2w23a_:

Sequence; same for both SEQRES and ATOM records:

>d2w23a_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvyllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpal

Timeline for d2w23a_:

• d2w23a_ first appeared in SCOPe 2.03
  
• d2w23a_ appears in SCOPe 2.06
  
• d2w23a_ appears in the current release, SCOPe 2.08