![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein Ascorbate oxidase [49555] (1 species) consists of three domains of this fold |
![]() | Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries) |
![]() | Domain d1asqa2: 1asq A:130-338 [23137] complexed with azi, cu, nag, oh |
PDB Entry: 1asq (more details), 2.32 Å
SCOPe Domain Sequences for d1asqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asqa2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} pfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdcsiaakydsn lepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvveadgnyvqpf ytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylpnsvsklpts pppqtpawddfdrsknftyritaamgspk
Timeline for d1asqa2: