SCOPe 2.08: Domain d1asqa2: 1asq A:130-338

Lineage for d1asqa2 (1asq A:130-338)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Ascorbate oxidase, middle domain [418903] (1 species)
   protein consists of three domains of this fold
7. Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [419305] (4 PDB entries)

8. Domain d1asqa2: 1asq A:130-338 [23137]
   Other proteins in same PDB: d1asqa1, d1asqa3, d1asqb1, d1asqb3
   complexed with azi, cu, nag, oh
   has additional insertions and/or extensions that are not grouped together

Details for d1asqa2

PDB Entry: 1asq, 2.32 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

PDB Compounds: (A:) ascorbate oxidase

SCOPe Domain Sequences for d1asqa2:

Sequence; same for both SEQRES and ATOM records:

>d1asqa2 b.6.1.3 (A:130-338) Ascorbate oxidase, middle domain {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
pfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdcsiaakydsn
lepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvveadgnyvqpf
ytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylpnsvsklpts
pppqtpawddfdrsknftyritaamgspk

Timeline for d1asqa2:

• d1asqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1asqa2 appears in SCOPe 2.07