SCOPe 2.08: Domain d2vyib_: 2vyi B:

Lineage for d2vyib_ (2vyi B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein automated matches [190103] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries)

8. Domain d2vyib_: 2vyi B: [231362]
   automated match to d2vyia1

Details for d2vyib_

PDB Entry: 2vyi, 2.4 Å

PDB Description: crystal structure of the tpr domain of human sgt

PDB Compounds: (B:) sgta protein

SCOPe Domain Sequences for d2vyib_:

Sequence; same for both SEQRES and ATOM records:

>d2vyib_ a.118.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnyagav
qdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkiaelk
lrea

Timeline for d2vyib_:

• d2vyib_ first appeared in SCOPe 2.03
  
• d2vyib_ appears in SCOPe 2.07