Class b: All beta proteins [48724] (176 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
Protein automated matches [190445] (5 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [225676] (21 PDB entries) |
Domain d2vxra2: 2vxr A:1089-1298 [231361] Other proteins in same PDB: d2vxra1 automated match to d3btaa2 complexed with gol, so4 |
PDB Entry: 2vxr (more details), 1.9 Å
SCOPe Domain Sequences for d2vxra2:
Sequence, based on SEQRES records: (download)
>d2vxra2 b.42.4.0 (A:1089-1298) automated matches {Clostridium botulinum [TaxId: 1491]} tntlkdfwgnplrydtqyylfnqgmqniyikyfskasmgetaprtnfnnaainyqnlylg lrfiikkasnsrninndnivregdyiylnidnisdesyrvyvlvnskeiqtqlflapind dptfydvlqikkyyekttyncqilcekdtktfglfgigkfvkdygyvwdtydnyfcisqw ylrriseninklrlgcnwqfipvdegwtel
>d2vxra2 b.42.4.0 (A:1089-1298) automated matches {Clostridium botulinum [TaxId: 1491]} tntlkdfwgnplrydtqyylfnqgmqniyikyfskasmgetaprtnfnnaainyqnlylg lrfiikkasnsrninndnivregdyiylnidnisdesyrvyvlvnskeiqtqlflapind dptfydvlqikkyyekttyncqilcekdtktfglfgigkfvkdywdtydnyfcisqwylr riseninklrlgcnwqfipvdegwtel
Timeline for d2vxra2: