Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (23 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [225675] (9 PDB entries) |
Domain d2vxra1: 2vxr A:868-1074 [231360] Other proteins in same PDB: d2vxra2 automated match to d3btaa1 complexed with gol, so4 |
PDB Entry: 2vxr (more details), 1.9 Å
SCOPe Domain Sequences for d2vxra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxra1 b.29.1.0 (A:868-1074) automated matches {Clostridium botulinum [TaxId: 1491]} nailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqskfvvyd smfdnfsinfwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvna ksksiffeysikdnisdyinkwfsititndrlgnaniyingslkksekilnldrinssnd idfklinctdttkfvwikdfnifgrel
Timeline for d2vxra1: