SCOPe 2.03: Domain d2vxra1: 2vxr A:868-1074

Lineage for d2vxra1 (2vxr A:868-1074)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (9 PDB entries)

8. Domain d2vxra1: 2vxr A:868-1074 [231360]
   Other proteins in same PDB: d2vxra2
   automated match to d3btaa1
   complexed with gol, so4

Details for d2vxra1

PDB Entry: 2vxr, 1.9 Å

PDB Description: crystal structure of the botulinum neurotoxin serotype g binding domain

PDB Compounds: (A:) botulinum neurotoxin type g

SCOPe Domain Sequences for d2vxra1:

Sequence; same for both SEQRES and ATOM records:

>d2vxra1 b.29.1.0 (A:868-1074) automated matches {Clostridium botulinum [TaxId: 1491]}
nailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqskfvvyd
smfdnfsinfwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvna
ksksiffeysikdnisdyinkwfsititndrlgnaniyingslkksekilnldrinssnd
idfklinctdttkfvwikdfnifgrel

Timeline for d2vxra1:

• d2vxra1 is new in SCOPe 2.03-stable
  
• d2vxra1 appears in SCOPe 2.04
  
• d2vxra1 appears in the current release, SCOPe 2.08