Lineage for d2vxra1 (2vxr A:868-1088)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (54 species)
    not a true protein
  7. 2375214Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2375219Domain d2vxra1: 2vxr A:868-1088 [231360]
    Other proteins in same PDB: d2vxra2
    automated match to d3btaa1
    complexed with gol, so4

Details for d2vxra1

PDB Entry: 2vxr (more details), 1.9 Å

PDB Description: crystal structure of the botulinum neurotoxin serotype g binding domain
PDB Compounds: (A:) botulinum neurotoxin type g

SCOPe Domain Sequences for d2vxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxra1 b.29.1.0 (A:868-1088) automated matches {Clostridium botulinum [TaxId: 1491]}
nailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqskfvvyd
smfdnfsinfwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvna
ksksiffeysikdnisdyinkwfsititndrlgnaniyingslkksekilnldrinssnd
idfklinctdttkfvwikdfnifgrelnatevsslywiqss

SCOPe Domain Coordinates for d2vxra1:

Click to download the PDB-style file with coordinates for d2vxra1.
(The format of our PDB-style files is described here.)

Timeline for d2vxra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vxra2