Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries) |
Domain d2vx2g_: 2vx2 G: [231359] automated match to d4k2na_ |
PDB Entry: 2vx2 (more details), 2.3 Å
SCOPe Domain Sequences for d2vx2g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vx2g_ c.14.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rptsarqldgirnivlsnpkkrntlslamlkslqsdilhdadsndlkviiisaegpvfss ghdlkelteeqgrdyhaevfqtcskvmmhirnhpvpviamvnglataagcqlvascdiav asdkssfatpgvnvglfcstpgvalaravprkvalemlftgepisaqeallhgllskvvp eaelqeetmriarkiaslsrpvvslgkatfykqlpqdlgtayyltsqamvdnlalrdgqe gitaflqkrkpvw
Timeline for d2vx2g_: