| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Escherichia coli [TaxId:562] [231350] (1 PDB entry) |
| Domain d2vula_: 2vul A: [231351] automated match to d1igoa_ complexed with 12p, so4; mutant |
PDB Entry: 2vul (more details), 1.9 Å
SCOPe Domain Sequences for d2vula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vula_ b.29.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
aqtcltspqtgfhngffysfwkdspgtvnfclleggrytsnwsginnwvggkgwqtgsrr
nitysgsfntpgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydi
yraqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimate
gyqssgssditvs
Timeline for d2vula_: