Lineage for d2vula_ (2vul A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780844Species Escherichia coli [TaxId:562] [231350] (1 PDB entry)
  8. 2780845Domain d2vula_: 2vul A: [231351]
    automated match to d1igoa_
    complexed with 12p, so4; mutant

Details for d2vula_

PDB Entry: 2vul (more details), 1.9 Å

PDB Description: thermostable mutant of environmentally isolated gh11 xylanase
PDB Compounds: (A:) gh11 xylanase

SCOPe Domain Sequences for d2vula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vula_ b.29.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
aqtcltspqtgfhngffysfwkdspgtvnfclleggrytsnwsginnwvggkgwqtgsrr
nitysgsfntpgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydi
yraqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimate
gyqssgssditvs

SCOPe Domain Coordinates for d2vula_:

Click to download the PDB-style file with coordinates for d2vula_.
(The format of our PDB-style files is described here.)

Timeline for d2vula_: