Lineage for d2vuaa2 (2vua A:1080-1297)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053907Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2053945Protein automated matches [229100] (4 species)
    not a true protein
  7. 2053946Species Clostridium botulinum [TaxId:1491] [229101] (9 PDB entries)
  8. 2053947Domain d2vuaa2: 2vua A:1080-1297 [231349]
    Other proteins in same PDB: d2vuaa1, d2vuaa3
    automated match to d3btaa2

Details for d2vuaa2

PDB Entry: 2vua (more details), 1.7 Å

PDB Description: crystal structure of the botulinum neurotoxin serotype a binding domain
PDB Compounds: (A:) botulinum neurotoxin a heavy chain

SCOPe Domain Sequences for d2vuaa2:

Sequence, based on SEQRES records: (download)

>d2vuaa2 b.42.4.2 (A:1080-1297) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerplq

Sequence, based on observed residues (ATOM records): (download)

>d2vuaa2 b.42.4.2 (A:1080-1297) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmksknditnkckmnlqdnngndigfigfhqfnniakl
vasnwynrqierssrtlgcswefipvddgwgerplq

SCOPe Domain Coordinates for d2vuaa2:

Click to download the PDB-style file with coordinates for d2vuaa2.
(The format of our PDB-style files is described here.)

Timeline for d2vuaa2: