| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
| Protein automated matches [229097] (6 species) not a true protein |
| Species Clostridium botulinum [TaxId:36826] [231344] (1 PDB entry) |
| Domain d2vu9a1: 2vu9 A:875-1079 [231345] Other proteins in same PDB: d2vu9a2, d2vu9a3, d2vu9a4 automated match to d3btaa1 complexed with mg |
PDB Entry: 2vu9 (more details), 1.6 Å
SCOPe Domain Sequences for d2vu9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vu9a1 b.29.1.6 (A:875-1079) automated matches {Clostridium botulinum [TaxId: 36826]}
dtsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivy
nsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeik
qrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnim
fkldgcrdthryiwikyfnlfdkel
Timeline for d2vu9a1: