Lineage for d2vu9a1 (2vu9 A:875-1079)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779820Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2779869Protein automated matches [229097] (6 species)
    not a true protein
  7. 2779889Species Clostridium botulinum [TaxId:36826] [231344] (1 PDB entry)
  8. 2779890Domain d2vu9a1: 2vu9 A:875-1079 [231345]
    Other proteins in same PDB: d2vu9a2, d2vu9a3, d2vu9a4
    automated match to d3btaa1
    complexed with mg

Details for d2vu9a1

PDB Entry: 2vu9 (more details), 1.6 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a binding domain in complex with gt1b
PDB Compounds: (A:) botulinum neurotoxin a heavy chain

SCOPe Domain Sequences for d2vu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vu9a1 b.29.1.6 (A:875-1079) automated matches {Clostridium botulinum [TaxId: 36826]}
dtsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivy
nsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeik
qrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnim
fkldgcrdthryiwikyfnlfdkel

SCOPe Domain Coordinates for d2vu9a1:

Click to download the PDB-style file with coordinates for d2vu9a1.
(The format of our PDB-style files is described here.)

Timeline for d2vu9a1: