Lineage for d2vm6a1 (2vm6 A:1-149)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021541Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 3021542Protein automated matches [195066] (5 species)
    not a true protein
  7. 3021546Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 3021560Domain d2vm6a1: 2vm6 A:1-149 [231342]
    Other proteins in same PDB: d2vm6a2
    automated match to d2voia_
    complexed with so4

Details for d2vm6a1

PDB Entry: 2vm6 (more details), 2.2 Å

PDB Description: human bcl2-a1 in complex with bim-bh3 peptide
PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d2vm6a1:

Sequence, based on SEQRES records: (download)

>d2vm6a1 f.1.4.0 (A:1-149) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkeveknlkscldnvn
vvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisy
fvaefimnntgewirqnggwengfvkkfe

Sequence, based on observed residues (ATOM records): (download)

>d2vm6a1 f.1.4.0 (A:1-149) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtdcefgyiyrlaqdylqcvlqipsktsrvlqnvafsvqkeveknlkscldnvnvvsvdt
artlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfvaefi
mnntgewirqnggwengfvkkfe

SCOPe Domain Coordinates for d2vm6a1:

Click to download the PDB-style file with coordinates for d2vm6a1.
(The format of our PDB-style files is described here.)

Timeline for d2vm6a1: