Lineage for d1asob2 (1aso B:130-338)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369433Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 369434Protein Ascorbate oxidase [49555] (1 species)
    consists of three domains of this fold
  7. 369435Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)
  8. 369458Domain d1asob2: 1aso B:130-338 [23134]

Details for d1asob2

PDB Entry: 1aso (more details), 2.2 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

SCOP Domain Sequences for d1asob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asob2 b.6.1.3 (B:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
pfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdcsiaakydsn
lepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvveadgnyvqpf
ytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylpnsvsklpts
pppqtpawddfdrsknftyritaamgspk

SCOP Domain Coordinates for d1asob2:

Click to download the PDB-style file with coordinates for d1asob2.
(The format of our PDB-style files is described here.)

Timeline for d1asob2: