Lineage for d1asob1 (1aso B:1-129)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2043853Protein Ascorbate oxidase [49555] (1 species)
    consists of three domains of this fold
  7. 2043854Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries)
  8. 2043864Domain d1asob1: 1aso B:1-129 [23133]
    complexed with cu, nag, oh

Details for d1asob1

PDB Entry: 1aso (more details), 2.2 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms
PDB Compounds: (B:) ascorbate oxidase

SCOPe Domain Sequences for d1asob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asob1 b.6.1.3 (B:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
vdppqgkke

SCOPe Domain Coordinates for d1asob1:

Click to download the PDB-style file with coordinates for d1asob1.
(The format of our PDB-style files is described here.)

Timeline for d1asob1: