| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Ascorbate oxidase, N-terminal domain [418902] (1 species) protein consists of three domains of this fold |
| Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [419304] (4 PDB entries) |
| Domain d1asob1: 1aso B:1-129 [23133] Other proteins in same PDB: d1asoa2, d1asoa3, d1asob2, d1asob3 complexed with cu, nag, oh |
PDB Entry: 1aso (more details), 2.2 Å
SCOPe Domain Sequences for d1asob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asob1 b.6.1.3 (B:1-129) Ascorbate oxidase, N-terminal domain {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
vdppqgkke
Timeline for d1asob1: