Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [231321] (14 PDB entries) |
Domain d2v0la2: 2v0l A:252-454 [231328] Other proteins in same PDB: d2v0la1 automated match to d3spta2 complexed with pg4, pge, so4, uri |
PDB Entry: 2v0l (more details), 2.2 Å
SCOPe Domain Sequences for d2v0la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v0la2 b.81.1.0 (A:252-454) automated matches {Haemophilus influenzae [TaxId: 727]} vmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvigndveikp ysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnhltyvgdse igsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatigagttitrdv genelvitrvaqrhiqgwqrpik
Timeline for d2v0la2: