SCOPe 2.08: Domain d2v0la2: 2v0l A:252-454

Lineage for d2v0la2 (2v0l A:252-454)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [231321] (14 PDB entries)

8. Domain d2v0la2: 2v0l A:252-454 [231328]
   Other proteins in same PDB: d2v0la1
   automated match to d3spta2
   complexed with pg4, pge, so4, uri

Details for d2v0la2

PDB Entry: 2v0l, 2.2 Å

PDB Description: characterization of substrate binding and catalysis of the potential antibacterial target n-acetylglucosamine-1-phosphate uridyltransferase (glmu)

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d2v0la2:

Sequence; same for both SEQRES and ATOM records:

>d2v0la2 b.81.1.0 (A:252-454) automated matches {Haemophilus influenzae [TaxId: 727]}
vmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvigndveikp
ysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnhltyvgdse
igsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatigagttitrdv
genelvitrvaqrhiqgwqrpik

Timeline for d2v0la2:

• d2v0la2 first appeared in SCOPe 2.03
  
• d2v0la2 appears in SCOPe 2.07