Lineage for d2v8oa1 (2v8o A:176-320)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114496Species Murray valley encephalitis virus [TaxId:11079] [231315] (1 PDB entry)
  8. 2114497Domain d2v8oa1: 2v8o A:176-320 [231316]
    automated match to d1yksa1

Details for d2v8oa1

PDB Entry: 2v8o (more details), 1.9 Å

PDB Description: structure of the murray valley encephalitis virus rna helicase to 1. 9a resolution
PDB Compounds: (A:) flavivirin protease ns3

SCOPe Domain Sequences for d2v8oa1:

Sequence, based on SEQRES records: (download)

>d2v8oa1 c.37.1.0 (A:176-320) automated matches {Murray valley encephalitis virus [TaxId: 11079]}
gpaynpemlkkrqltvldlhpgagktrrilpqiikdaiqkrlrtavlaptrvvaaemaea
lrglpvryltpavqrehsgneivdvmchatlthrlmsplrvpnynlfvmdeahftdpasi
aargyiatrveageaaaifmtatpp

Sequence, based on observed residues (ATOM records): (download)

>d2v8oa1 c.37.1.0 (A:176-320) automated matches {Murray valley encephalitis virus [TaxId: 11079]}
gpaynpemlkkrqltvldlhpgagktrrilpqiikdaiqkrlrtavlaptrvvaaemaea
lrglpvryltprehsgneivdvmchatlthrlmsplrvpnynlfvmdeahftdpasiaar
gyiatrveageaaaifmtatpp

SCOPe Domain Coordinates for d2v8oa1:

Click to download the PDB-style file with coordinates for d2v8oa1.
(The format of our PDB-style files is described here.)

Timeline for d2v8oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v8oa2