Lineage for d2v7oa1 (2v7o A:5-302)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1176 PDB entries)
  8. 2546572Domain d2v7oa1: 2v7o A:5-302 [231314]
    Other proteins in same PDB: d2v7oa2
    automated match to d2wela_
    complexed with drn, edo

Details for d2v7oa1

PDB Entry: 2v7o (more details), 2.25 Å

PDB Description: crystal structure of human calcium-calmodulin-dependent protein kinase ii gamma
PDB Compounds: (A:) calcium/calmodulin-dependent protein kinase type II gamma chain

SCOPe Domain Sequences for d2v7oa1:

Sequence, based on SEQRES records: (download)

>d2v7oa1 d.144.1.0 (A:5-302) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atctrftddyqlfeelgkgafsvvrrcvkktptqeyaakiintkklsardhqklereari
crllkhpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashcihqilesv
nhihqhdivhrdlkpenlllaskckgaavkladfglaievqgeqqawfgfagtpgylspe
vlrkdpygkpvdiwacgvilyillvgyppfwdedqhklyqqikagaydfpspewdtvtpe
aknlinqmltinpakritadqalkhpwvcqrstvasmmhrqetveclrkfnarrklkg

Sequence, based on observed residues (ATOM records): (download)

>d2v7oa1 d.144.1.0 (A:5-302) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atctrftddyqlfeelgkgfsvvrrcvkktptqeyaakiintkklsardhqklerearic
rllkhpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashcihqilesvn
hihqhdivhrdlkpenlllaskckgaavkladfglaievqgeqqawfgfagtpgylspev
lrkdpygkpvdiwacgvilyillvgyppfwdedqhklyqqikagaydfpspewdtvtpea
knlinqmltinpakritadqalkhpwvcqrstvasmmhrqetveclrkfnarrklkg

SCOPe Domain Coordinates for d2v7oa1:

Click to download the PDB-style file with coordinates for d2v7oa1.
(The format of our PDB-style files is described here.)

Timeline for d2v7oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v7oa2