Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries) |
Domain d2uyyd1: 2uyy D:263-429 [231293] Other proteins in same PDB: d2uyya2, d2uyyb2, d2uyyc2, d2uyyd2 automated match to d3ckyd1 complexed with k, na7 |
PDB Entry: 2uyy (more details), 2.5 Å
SCOPe Domain Sequences for d2uyyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uyyd1 c.2.1.0 (D:263-429) automated matches {Human (Homo sapiens) [TaxId: 9606]} itptdkkigflglglmgsgivsnllkmghtvtvwnrtaekcdlfiqegarlgrtpaevvs tcditfacvsdpkaakdlvlgpsgvlqgirpgkcyvdmstvdadtvtelaqvivsrggrf leapvsgnqqlsndgmlvilaagdrglyedcsscfqamgktsfflge
Timeline for d2uyyd1: