Lineage for d1aozb3 (1aoz B:339-552)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1774815Protein Ascorbate oxidase [49555] (1 species)
    consists of three domains of this fold
  7. 1774816Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries)
  8. 1774822Domain d1aozb3: 1aoz B:339-552 [23129]
    complexed with c1o, c2o, cu, nag

Details for d1aozb3

PDB Entry: 1aoz (more details), 1.9 Å

PDB Description: refined crystal structure of ascorbate oxidase at 1.9 angstroms resolution
PDB Compounds: (B:) ascorbate oxidase

SCOPe Domain Sequences for d1aozb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aozb3 b.6.1.3 (B:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

SCOPe Domain Coordinates for d1aozb3:

Click to download the PDB-style file with coordinates for d1aozb3.
(The format of our PDB-style files is described here.)

Timeline for d1aozb3: