SCOPe 2.08: Domain d2uv5a1: 2uv5 A:182-324

Lineage for d2uv5a1 (2uv5 A:182-324)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [231280] (4 PDB entries)

8. Domain d2uv5a1: 2uv5 A:182-324 [231282]
   Other proteins in same PDB: d2uv5a2
   automated match to d2nyca1
   complexed with amz

Details for d2uv5a1

PDB Entry: 2uv5, 1.69 Å

PDB Description: crystal structure of a cbs domain pair from the regulatory gamma1 subunit of human ampk in complex with amp

PDB Compounds: (A:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2uv5a1:

Sequence; same for both SEQRES and ATOM records:

>d2uv5a1 d.37.1.0 (A:182-324) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiy
skfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlv
vvdendvvkgivslsdilqalvl

Timeline for d2uv5a1:

• d2uv5a1 first appeared in SCOPe 2.03, called d2uv5a_
  
• d2uv5a1 appears in SCOPe 2.07