Lineage for d2uv5a1 (2uv5 A:182-324)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943453Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2943454Protein automated matches [191100] (15 species)
    not a true protein
  7. 2943491Species Human (Homo sapiens) [TaxId:9606] [231280] (4 PDB entries)
  8. 2943493Domain d2uv5a1: 2uv5 A:182-324 [231282]
    Other proteins in same PDB: d2uv5a2
    automated match to d2nyca1
    complexed with amz

Details for d2uv5a1

PDB Entry: 2uv5 (more details), 1.69 Å

PDB Description: crystal structure of a cbs domain pair from the regulatory gamma1 subunit of human ampk in complex with amp
PDB Compounds: (A:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2uv5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uv5a1 d.37.1.0 (A:182-324) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiy
skfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlv
vvdendvvkgivslsdilqalvl

SCOPe Domain Coordinates for d2uv5a1:

Click to download the PDB-style file with coordinates for d2uv5a1.
(The format of our PDB-style files is described here.)

Timeline for d2uv5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uv5a2