Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [231280] (4 PDB entries) |
Domain d2uv4a1: 2uv4 A:182-324 [231281] Other proteins in same PDB: d2uv4a2 automated match to d2nyca1 complexed with amp |
PDB Entry: 2uv4 (more details), 1.33 Å
SCOPe Domain Sequences for d2uv4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uv4a1 d.37.1.0 (A:182-324) automated matches {Human (Homo sapiens) [TaxId: 9606]} efpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiy skfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlv vvdendvvkgivslsdilqalvl
Timeline for d2uv4a1: