![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein automated matches [190100] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries) |
![]() | Domain d2riib_: 2rii B: [231277] Other proteins in same PDB: d2riix_, d2riiy_ automated match to d1qmva_ complexed with po4 |
PDB Entry: 2rii (more details), 2.6 Å
SCOPe Domain Sequences for d2riib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2riib_ c.47.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sgnakighpapnfkatavmpdgqfkdislsdykgkyvvfffypldftfvcpteiiafsdr aeefkklnsqvigasvdshfehlawvntpkkqgglgpmniplvsdpkrtiaqdygvlkad egisfrglfiiddkgilrqitvndlpvgrsvdetlrlvqafqftdkhgevspagwkpgsd tikpd
Timeline for d2riib_: