| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Roseovarius nubinhibens [TaxId:89187] [225250] (4 PDB entries) |
| Domain d2rdxb1: 2rdx B:0-127 [231263] Other proteins in same PDB: d2rdxa2, d2rdxb2, d2rdxc2, d2rdxd2, d2rdxe2 automated match to d4mggf1 complexed with gol, mg |
PDB Entry: 2rdx (more details), 2 Å
SCOPe Domain Sequences for d2rdxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdxb1 d.54.1.0 (B:0-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
pvwmllgg
Timeline for d2rdxb1: