Lineage for d2rdxb1 (2rdx B:0-127)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413233Species Roseovarius nubinhibens [TaxId:89187] [225250] (4 PDB entries)
  8. 1413243Domain d2rdxb1: 2rdx B:0-127 [231263]
    Other proteins in same PDB: d2rdxa2, d2rdxb2, d2rdxc2, d2rdxd2, d2rdxe2
    automated match to d4mggf1
    complexed with gol, mg

Details for d2rdxb1

PDB Entry: 2rdx (more details), 2 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme, putative

SCOPe Domain Sequences for d2rdxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdxb1 d.54.1.0 (B:0-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
pvwmllgg

SCOPe Domain Coordinates for d2rdxb1:

Click to download the PDB-style file with coordinates for d2rdxb1.
(The format of our PDB-style files is described here.)

Timeline for d2rdxb1: