Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [224865] (3 PDB entries) |
Domain d2rdhd1: 2rdh D:6-93 [231261] Other proteins in same PDB: d2rdha2, d2rdhb2, d2rdhc2, d2rdhd2 automated match to d3o13a1 complexed with na, po4 |
PDB Entry: 2rdh (more details), 1.7 Å
SCOPe Domain Sequences for d2rdhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdhd1 b.40.2.0 (D:6-93) automated matches {Staphylococcus aureus [TaxId: 158878]} rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl dvfvvregsgrqadnnsiggitktnrtq
Timeline for d2rdhd1: