Lineage for d1aoza3 (1aoz A:339-552)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369433Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 369434Protein Ascorbate oxidase [49555] (1 species)
    consists of three domains of this fold
  7. 369435Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)
  8. 369438Domain d1aoza3: 1aoz A:339-552 [23126]

Details for d1aoza3

PDB Entry: 1aoz (more details), 1.9 Å

PDB Description: refined crystal structure of ascorbate oxidase at 1.9 angstroms resolution

SCOP Domain Sequences for d1aoza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

SCOP Domain Coordinates for d1aoza3:

Click to download the PDB-style file with coordinates for d1aoza3.
(The format of our PDB-style files is described here.)

Timeline for d1aoza3: