![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
![]() | Protein automated matches [226841] (4 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [224923] (2 PDB entries) |
![]() | Domain d2rdhb2: 2rdh B:94-196 [231258] Other proteins in same PDB: d2rdha1, d2rdhb1, d2rdhc1, d2rdhd1 automated match to d3o13a2 complexed with na, po4 |
PDB Entry: 2rdh (more details), 1.7 Å
SCOPe Domain Sequences for d2rdhb2:
Sequence, based on SEQRES records: (download)
>d2rdhb2 d.15.6.0 (B:94-196) automated matches {Staphylococcus aureus [TaxId: 158878]} hidtvqnvnllvskstgqhttsvtstnysiykeeislkeldfklrkhlidkhdlyktepk dskirvtmkngdfytfelnkklqthrmgdvidgrniekievnl
>d2rdhb2 d.15.6.0 (B:94-196) automated matches {Staphylococcus aureus [TaxId: 158878]} hitvqnvnllvskstgqhttsvtstnysiykeeislkeldfklrkhlidkhdlyktepkd skirvtmkngdfytfelnkklqthrmgdvidgrniekievnl
Timeline for d2rdhb2: