SCOPe 2.08: Domain d2rdhb1: 2rdh B:6-93

Lineage for d2rdhb1 (2rdh B:6-93)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [224865] (3 PDB entries)

8. Domain d2rdhb1: 2rdh B:6-93 [231257]
   Other proteins in same PDB: d2rdha2, d2rdhb2, d2rdhc2, d2rdhd2
   automated match to d3o13a1
   complexed with na, po4

Details for d2rdhb1

PDB Entry: 2rdh, 1.7 Å

PDB Description: Crystal structure of Staphylococcal Superantigen-Like protein 11

PDB Compounds: (B:) Superantigen-like protein 11

SCOPe Domain Sequences for d2rdhb1:

Sequence; same for both SEQRES and ATOM records:

>d2rdhb1 b.40.2.0 (B:6-93) automated matches {Staphylococcus aureus [TaxId: 158878]}
rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
dvfvvregsgrqadnnsiggitktnrtq

Timeline for d2rdhb1:

• d2rdhb1 first appeared in SCOPe 2.03
  
• d2rdhb1 appears in SCOPe 2.07