![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
![]() | Protein automated matches [226841] (6 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries) |
![]() | Domain d2rdga2: 2rdg A:94-196 [231256] Other proteins in same PDB: d2rdga1 automated match to d3o13a2 complexed with cit, k |
PDB Entry: 2rdg (more details), 1.6 Å
SCOPe Domain Sequences for d2rdga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdga2 d.15.6.0 (A:94-196) automated matches {Staphylococcus aureus [TaxId: 1280]} hidtvqnvnllvskstgqhttsvtstnysiykeeislkeldfklrkhlidkhdlyktepk dskirvtmkngdfytfelnkklqthrmgdvidgrniekievnl
Timeline for d2rdga2: