Lineage for d2rdga2 (2rdg A:94-196)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934588Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)
  8. 2934590Domain d2rdga2: 2rdg A:94-196 [231256]
    Other proteins in same PDB: d2rdga1
    automated match to d3o13a2
    complexed with cit, k

Details for d2rdga2

PDB Entry: 2rdg (more details), 1.6 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl lewis x
PDB Compounds: (A:) Superantigen-like protein 11

SCOPe Domain Sequences for d2rdga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdga2 d.15.6.0 (A:94-196) automated matches {Staphylococcus aureus [TaxId: 1280]}
hidtvqnvnllvskstgqhttsvtstnysiykeeislkeldfklrkhlidkhdlyktepk
dskirvtmkngdfytfelnkklqthrmgdvidgrniekievnl

SCOPe Domain Coordinates for d2rdga2:

Click to download the PDB-style file with coordinates for d2rdga2.
(The format of our PDB-style files is described here.)

Timeline for d2rdga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rdga1