![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
![]() | Protein automated matches [226834] (5 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [225054] (9 PDB entries) |
![]() | Domain d2rdha1: 2rdh A:6-93 [231253] Other proteins in same PDB: d2rdha2, d2rdhb2, d2rdhc2, d2rdhd2 automated match to d3o13a1 complexed with na, po4 |
PDB Entry: 2rdh (more details), 1.7 Å
SCOPe Domain Sequences for d2rdha1:
Sequence, based on SEQRES records: (download)
>d2rdha1 b.40.2.0 (A:6-93) automated matches {Staphylococcus aureus [TaxId: 1280]} rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl dvfvvregsgrqadnnsiggitktnrtq
>d2rdha1 b.40.2.0 (A:6-93) automated matches {Staphylococcus aureus [TaxId: 1280]} rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl dvfvvrednnsiggitktnrtq
Timeline for d2rdha1: