Lineage for d2raha_ (2rah A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010931Species Human (Homo sapiens) [TaxId:9606] [231251] (2 PDB entries)
  8. 2010932Domain d2raha_: 2rah A: [231252]
    automated match to d3id0a_
    complexed with 11p, mg, so4

Details for d2raha_

PDB Entry: 2rah (more details), 2 Å

PDB Description: Human FDPS synthase in complex with novel inhibitor
PDB Compounds: (A:) Farnesyl pyrophosphate synthetase

SCOPe Domain Sequences for d2raha_:

Sequence, based on SEQRES records: (download)

>d2raha_ a.128.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiy

Sequence, based on observed residues (ATOM records): (download)

>d2raha_ a.128.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedehpeigdaiarlkevleynaiggkynrgltvvvafr
elveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldai
ndanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrft
ekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlf
gdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeld
lpavflqyeedsyshimalieqyaaplppavflglarkiy

SCOPe Domain Coordinates for d2raha_:

Click to download the PDB-style file with coordinates for d2raha_.
(The format of our PDB-style files is described here.)

Timeline for d2raha_: